Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MISIIWFLFFFIFFSYLKVIKIDSFLVYHTSAMKNLTQNLLKKDNSSILKIELKKENNKSMKISKKAFLLVVLILLSTLYSVNFMRNAQEIYTTGDLSFHLSRIKGLSSIFEGPINYTTFNNYGDGLNYFYPFLTIIPAVVFYGISNNLILSYVLYIWLLNICTILISFWERQ 5NVR Chain:A ((898-966)) --------------------------------------------------------------------------------------------------LHLA-ANPIEPLFSGLLNFCIKNN-ADHLDEFCGN-T---SEVLFKISPELLLKLLTY-----------------

General information: TITO was launched using: RESULT: Template: 5NVR.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 107 -3087 -28.85 -59.36 target 2D structure prediction score : 0.37 Monomeric hydrophicity matching model chain A : 0.51 3D Compatibility (PKB) : -28.85 2D Compatibility (Sec. Struct. Predict.) : 0.37 1D Compatibility (Hydrophobicity) : 0.51 QMean score : -0.211

(partial model without unconserved sides chains): PDB file : Tito_5NVR.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5NVR-query.scw PDB file : Tito_Scwrl_5NVR.pdb: