Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MSVSRIIFAYFPTTAISYKLFATKRGVVTKFCHNPSFLINGVQ 4XT3 Chain:B ((40-55)) -------------------ILETRQH--RLFCADPKE------

General information: TITO was launched using: RESULT: Template: 4XT3.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 14 -3762 -268.68 -235.09 target 2D structure prediction score : 0.25 Monomeric hydrophicity matching model chain B : 0.47 3D Compatibility (PKB) : -268.68 2D Compatibility (Sec. Struct. Predict.) : 0.25 1D Compatibility (Hydrophobicity) : 0.47 QMean score : 0.818

(partial model without unconserved sides chains): PDB file : Tito_4XT3.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4XT3-query.scw PDB file : Tito_Scwrl_4XT3.pdb: