Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKNKFENRSDTRCGSFLYILYEVFFIPYEKISLKIKKDENKRFSIKRRPFIFCLYLCEKRKRAQHIKLLLIVCLL 1QMB Chain:B ((365-376)) --------------------------------------------KFNAPFVFLMIE-------------------

General information: TITO was launched using: RESULT: Template: 1QMB.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 1 -446 -446.00 -37.17 target 2D structure prediction score : 0.50 Monomeric hydrophicity matching model chain B : 0.54 3D Compatibility (PKB) : -446.00 2D Compatibility (Sec. Struct. Predict.) : 0.50 1D Compatibility (Hydrophobicity) : 0.54 QMean score : 0.400

(partial model without unconserved sides chains): PDB file : Tito_1QMB.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1QMB-query.scw PDB file : Tito_Scwrl_1QMB.pdb: