Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MTNDWLIQQLDELSEKSEYQDRALLYEIKKLMAEIDERTMQLQGEIDGQSWNHLNW 3QLX Chain:A ((150-193)) ------IPQMDTFLQKQELEQR--FYDNSDKLVDFLPSSIQLEGRLTSQEWN----

General information: TITO was launched using: RESULT: Template: 3QLX.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 26 -847 -32.56 -19.24 target 2D structure prediction score : 0.18 Monomeric hydrophicity matching model chain A : 0.73 3D Compatibility (PKB) : -32.56 2D Compatibility (Sec. Struct. Predict.) : 0.18 1D Compatibility (Hydrophobicity) : 0.73 QMean score : 0.507

(partial model without unconserved sides chains): PDB file : Tito_3QLX.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3QLX-query.scw PDB file : Tito_Scwrl_3QLX.pdb: