Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceWYQGEMSRKEAEGLLEK---DGDFLVRKSTTNPGSFVLTGMHNGQAKHL-LLVDPEGTIRTKDRVFDSISHLINHH
1ZFP Chain:E ((5-80))WFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELVDYH


General information:
TITO was launched using:
RESULT:

Template: 1ZFP.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain E - contact count / total energy / energy per contact / energy per residue : 244 8683 35.58 120.59
target 2D structure prediction score : 0.76
Monomeric hydrophicity matching model chain E : 0.76

3D Compatibility (PKB) : 35.58
2D Compatibility (Sec. Struct. Predict.) : 0.76
1D Compatibility (Hydrophobicity) : 0.76
QMean score : 0.764

(partial model without unconserved sides chains):
PDB file : Tito_1ZFP.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1ZFP-query.scw
PDB file : Tito_Scwrl_1ZFP.pdb: