Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MEVKKLTREEVFNKVAKIISNHFEIDTDKVTDELNIKDDLKADSISIMEFVLELEDEFGTEISDEDAEQIETVGGAVDYISSHLK 4IHF Chain:G ((5-78)) ---------TIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEAEKITTVQAAIDYINGH--

General information: TITO was launched using: RESULT: Template: 4IHF.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain G - contact count / total energy / energy per contact / energy per residue : 259 -39313 -151.79 -531.26 target 2D structure prediction score : 0.81 Monomeric hydrophicity matching model chain G : 0.84 3D Compatibility (PKB) : -151.79 2D Compatibility (Sec. Struct. Predict.) : 0.81 1D Compatibility (Hydrophobicity) : 0.84 QMean score : 0.771

(partial model without unconserved sides chains): PDB file : Tito_4IHF.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4IHF-query.scw PDB file : Tito_Scwrl_4IHF.pdb: