Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceWYHGAIPRAEVAELLV----HSGDFLVRESQGKQ-EYVLSVLWDGLPRHFIIQAHA-PSEWRLLT
3PQZ Chain:A ((16-78))WFHGRISREESQRLIGQQGLVDGLFLVRESQR-PQGFVLSLCHLQKVKHYLILPSEEEGRLYF--


General information:
TITO was launched using:
RESULT:

Template: 3PQZ.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 179 907 5.06 16.19
target 2D structure prediction score : 0.68
Monomeric hydrophicity matching model chain A : 0.73

3D Compatibility (PKB) : 5.06
2D Compatibility (Sec. Struct. Predict.) : 0.68
1D Compatibility (Hydrophobicity) : 0.73
QMean score : 0.610

(partial model without unconserved sides chains):
PDB file : Tito_3PQZ.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-3PQZ-query.scw
PDB file : Tito_Scwrl_3PQZ.pdb: