Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMFISFEGTEGVGKTTLIRKIHQHFEEQGKQVVLTR-EPGGTPLAEQIRSMLLAVNHDENMSHDTELLLIYAARAQHLQQVILPALESNKIVLSDRFTDASFAYQCSGRGLSQDKLQLLNQNFV-SRMPEVTFWLDAPIELGMNRARERGALDRFEQEKLSFFTKVREGYETLWKAEPERIKRLDATQSPDQVFEQALQYLA
3LV8 Chain:A ((28-226))KFIVIEGLEGAGKSTAIQVVVETLQQNGIDHITRTREPGGTLLAEKLRALVKEEHPGEELQDITELLLVYAARVQLVENVIKPALARGEWVVGDRHDMSSQAYQGGGRQIAPSTMQSLKQTALGDFKPDLTLYLDIDPKLGLER-----ELDRIEKMDISFFERARERYLELANSD-DSVVMIDAAQSIEQVTADIRRAL-


General information:
TITO was launched using:
RESULT:

Template: 3LV8.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 904 19864 21.97 103.46
target 2D structure prediction score : 0.72
Monomeric hydrophicity matching model chain A : 0.79

3D Compatibility (PKB) : 21.97
2D Compatibility (Sec. Struct. Predict.) : 0.72
1D Compatibility (Hydrophobicity) : 0.79
QMean score : 0.487

(partial model without unconserved sides chains):
PDB file : Tito_3LV8.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-3LV8-query.scw
PDB file : Tito_Scwrl_3LV8.pdb: