Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence WYHGAISRAEAESRLQPCKEAGYLVRNSESGNSRYSIALKTSQGCVHIIVAQTKDNKYTLNQTSAVFDSIPEVVHYY 2CS0 Chain:A ((18-93)) WFHGAISREDAENLLESQPLGSFLIRVSHSHVG-YTLSYKAQSSCCHFMVKLLDDGTFMIPGEKVAHTSLDALVTFH

General information: TITO was launched using: RESULT: Template: 2CS0.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 279 -49630 -177.88 -653.02 target 2D structure prediction score : 0.74 Monomeric hydrophicity matching model chain A : 0.76 3D Compatibility (PKB) : -177.88 2D Compatibility (Sec. Struct. Predict.) : 0.74 1D Compatibility (Hydrophobicity) : 0.76 QMean score : 0.663

(partial model without unconserved sides chains): PDB file : Tito_2CS0.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2CS0-query.scw PDB file : Tito_Scwrl_2CS0.pdb: