Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceWLYEGLSREKAEELLLLPGNPGGAFLIRESQTRRGSYSLSVRLSRPASWDRIRHYRIHCLDNGWLYISPRLTFPSLQALVDHY
1A08 Chain:B ((9-91))WYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYY


General information:
TITO was launched using:
RESULT:

Template: 1A08.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 309 -47932 -155.12 -577.49
target 2D structure prediction score : 0.80
Monomeric hydrophicity matching model chain B : 0.84

3D Compatibility (PKB) : -155.12
2D Compatibility (Sec. Struct. Predict.) : 0.80
1D Compatibility (Hydrophobicity) : 0.84
QMean score : 0.679

(partial model without unconserved sides chains):
PDB file : Tito_1A08.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1A08-query.scw
PDB file : Tito_Scwrl_1A08.pdb: