Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence GKNGLKDCQVSITATSEARRSFWDTQYADYNDDVEISAGRHKFVIHVEQDCGGSKVSGTIPPHHLVILSPMSGGGRRTIINSAGEVRLAAT 2R9Q Chain:B ((240-296)) --------------------DFWEPLFARGRAELILDPDEFYIL--------VSREAVHVPPLYAAEMTPFDPLVGEFRVHYAG-------

General information: TITO was launched using: RESULT: Template: 2R9Q.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 58 -10973 -189.19 -195.95 target 2D structure prediction score : 0.64 Monomeric hydrophicity matching model chain B : 0.66 3D Compatibility (PKB) : -189.19 2D Compatibility (Sec. Struct. Predict.) : 0.64 1D Compatibility (Hydrophobicity) : 0.66 QMean score : 0.153

(partial model without unconserved sides chains): PDB file : Tito_2R9Q.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2R9Q-query.scw PDB file : Tito_Scwrl_2R9Q.pdb: