Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKVILRNLSIHHNSNLRNFIEAILYRIRTGCPWRDIPSCFG-HSNSIFKRFNRWSSSGDLLRLFKLLASYPDMEWIFIDGSHVRAHQHSASIANQSIVD 2JRT Chain:A ((31-78)) -----------RRWVASRKAAVVKAVIHGLITEREALDRYSLSEEEFALWRSAVAAHGE----------------------------------------

General information: TITO was launched using: RESULT: Template: 2JRT.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 130 -11136 -85.66 -236.93 target 2D structure prediction score : 0.83 Monomeric hydrophicity matching model chain A : 0.53 3D Compatibility (PKB) : -85.66 2D Compatibility (Sec. Struct. Predict.) : 0.83 1D Compatibility (Hydrophobicity) : 0.53 QMean score : 0.589

(partial model without unconserved sides chains): PDB file : Tito_2JRT.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2JRT-query.scw PDB file : Tito_Scwrl_2JRT.pdb: