Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MVQSINTKVDLVIDATSFTGLTDYGQIMIGDNGFEFYHARDRRKYIQIPWEEVDYVLASVMLKGKWIPRYAIQTKKNGTYTFSSKEP-KKVLRAIREYVDEDRMVQSLSFFDVVKRGIRSMFKRK 4TYZ Chain:B ((31-104)) --------------------ALKQGYLFITPHWLCFQSTLA-AAHFSIEYDEIKDIIKSKSVK-MFENAIEVKTHLNDTIFLTNFLQRDQAYSALM-----------------------------

General information: TITO was launched using: RESULT: Template: 4TYZ.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 240 -28256 -117.73 -387.07 target 2D structure prediction score : 0.51 Monomeric hydrophicity matching model chain B : 0.60 3D Compatibility (PKB) : -117.73 2D Compatibility (Sec. Struct. Predict.) : 0.51 1D Compatibility (Hydrophobicity) : 0.60 QMean score : 0.595

(partial model without unconserved sides chains): PDB file : Tito_4TYZ.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4TYZ-query.scw PDB file : Tito_Scwrl_4TYZ.pdb: