Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence PIDIQQSRTKDEQPHSGDCKVEILHDWFTEPFLVYRANPGSRSEITIETHSAPVVFAFAIGSGCRGIKDKKAGKIPEGFFVKISTIGISGAHFLRD 3PP1 Chain:A ((96-153)) ---------------------------------------------------------------------KKAGRIPEQILGKVSIAVIKGLTYLRE

General information: TITO was launched using: RESULT: Template: 3PP1.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 8 -2088 -260.94 -77.31 target 2D structure prediction score : 0.37 Monomeric hydrophicity matching model chain A : 0.63 3D Compatibility (PKB) : -260.94 2D Compatibility (Sec. Struct. Predict.) : 0.37 1D Compatibility (Hydrophobicity) : 0.63 QMean score : 0.086

(partial model without unconserved sides chains): PDB file : Tito_3PP1.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3PP1-query.scw PDB file : Tito_Scwrl_3PP1.pdb: