Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence NCSVQVLDANNFQIGTACIPKGGQGSVRYN-GGSYFITATSSCGLGFVSTQTHPAGWQLKLLGNC 2LO7 Chain:A ((1-23)) --------------GSGCMKEYCAGQCRGKVSQDYCL----------------------------

General information: TITO was launched using: RESULT: Template: 2LO7.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 40 -2261 -56.53 -102.77 target 2D structure prediction score : 0.27 Monomeric hydrophicity matching model chain A : 0.58 3D Compatibility (PKB) : -56.53 2D Compatibility (Sec. Struct. Predict.) : 0.27 1D Compatibility (Hydrophobicity) : 0.58 QMean score : 0.333

(partial model without unconserved sides chains): PDB file : Tito_2LO7.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2LO7-query.scw PDB file : Tito_Scwrl_2LO7.pdb: