Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence CFHHKISRDEAQRLIIQQGLVDGVFLVRDSQSNPKTFVLSMSHGQKIKHFQIIPVEDDGEMFHTLDDGHTRFTDLIQLVEFY 4X6S Chain:A ((432-512)) -FHGRISREESQRLIGQQGLVDGLFLVRESQRNPQGFVLSLCHLQKVKHYLILPSEEEGRLYFSMDDGQTRFTDLLQLVEFH

General information: TITO was launched using: RESULT: Template: 4X6S.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 285 -45672 -160.25 -563.85 target 2D structure prediction score : 0.85 Monomeric hydrophicity matching model chain A : 0.93 3D Compatibility (PKB) : -160.25 2D Compatibility (Sec. Struct. Predict.) : 0.85 1D Compatibility (Hydrophobicity) : 0.93 QMean score : 0.606

(partial model without unconserved sides chains): PDB file : Tito_4X6S.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4X6S-query.scw PDB file : Tito_Scwrl_4X6S.pdb: