Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence WFHGKISKQEAYNLLMTVGQVCSFLVRPSDNTPGDYSLYFRTNENIQRLKICPTPNNQFMMGGRYYNSIGDIIDHY 4OHD Chain:A ((6-113)) WFHPNITGVEAENLLLTRGVDGSFLARPSKSNPGDFTLSVRRNGAVTHIKIQNTGDYYDLYGGEKFATLAELVQYY

General information: TITO was launched using: RESULT: Template: 4OHD.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 288 -42361 -147.09 -557.38 target 2D structure prediction score : 0.67 Monomeric hydrophicity matching model chain A : 0.79 3D Compatibility (PKB) : -147.09 2D Compatibility (Sec. Struct. Predict.) : 0.67 1D Compatibility (Hydrophobicity) : 0.79 QMean score : 0.666

(partial model without unconserved sides chains): PDB file : Tito_4OHD.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4OHD-query.scw PDB file : Tito_Scwrl_4OHD.pdb: