Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence WLFEGLGRDKAEELLQLPDTKVGSFMIRESETKKGFYSLSVRH---RQ---VKHYRIFRLPNNWYYISPRLTFQCLEDLVN 3VS2 Chain:A ((72-165)) WFFKGISRKDAERQLLAPGNMLGSFMIRDSETTKGSYSLSVRDYDPRQGDTVKHYKIRTL---GFYISPRSTFSTLQELVD

General information: TITO was launched using: RESULT: Template: 3VS2.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 230 -12792 -55.62 -177.66 target 2D structure prediction score : 0.63 Monomeric hydrophicity matching model chain A : 0.86 3D Compatibility (PKB) : -55.62 2D Compatibility (Sec. Struct. Predict.) : 0.63 1D Compatibility (Hydrophobicity) : 0.86 QMean score : 0.588

(partial model without unconserved sides chains): PDB file : Tito_3VS2.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3VS2-query.scw PDB file : Tito_Scwrl_3VS2.pdb: