Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence WYWGDISREEVNDKLRDMPDGTFLVRDASTKMQGDYTLTLRKGGNNKLIKTYHRDGKYGFSDPLTFNSVVELINHY 3HIZ Chain:B ((333-427)) WYWGDISREEVNEKLRDTADGTFLVRDASTKMHGDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLTFSSVVELINHY

General information: TITO was launched using: RESULT: Template: 3HIZ.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 252 -29977 -118.95 -394.43 target 2D structure prediction score : 0.74 Monomeric hydrophicity matching model chain B : 0.98 3D Compatibility (PKB) : -118.95 2D Compatibility (Sec. Struct. Predict.) : 0.74 1D Compatibility (Hydrophobicity) : 0.98 QMean score : 0.754

(partial model without unconserved sides chains): PDB file : Tito_3HIZ.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3HIZ-query.scw PDB file : Tito_Scwrl_3HIZ.pdb: