Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMFKTFL-----KDKEKIVNALQLPYSNAKLEATNNLIKLIKHNAFGFRNFENFKKERT---KFVLSRSSLSSTHYS-
2N2U Chain:A ((1-77))MVDLKIDVSDDEEAEKIIREIREQWPKATVTRTNGDIKLDAQTEKEAEKMEKAVKKVKPNATIRKTGGSLEHHHHHH


General information:
TITO was launched using:
RESULT:

Template: 2N2U.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 283 36822 130.11 541.49
target 2D structure prediction score : 0.56
Monomeric hydrophicity matching model chain A : 0.70

3D Compatibility (PKB) : 130.11
2D Compatibility (Sec. Struct. Predict.) : 0.56
1D Compatibility (Hydrophobicity) : 0.70
QMean score : 0.448

(partial model without unconserved sides chains):
PDB file : Tito_2N2U.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-2N2U-query.scw
PDB file : Tito_Scwrl_2N2U.pdb: