Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MILRHLGISPTNDLVAKKIFSNPEITCQFIRDMLDLPAKNVTILEGSDIHVLLSMPY-SVQDFYTSIDVLAELDNGTQVIIEIQVHHQNFFINHLWAYLCSQVNQNLEKIHQREGDTH 3R5L Chain:A ((65-112)) --------------------ANPKVQVQIKKEVLDLTARDATDEERAEYWPQLVTMYPSYQDYQSWTD--------------------------------------------------

General information: TITO was launched using: RESULT: Template: 3R5L.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 75 -4756 -63.41 -101.18 target 2D structure prediction score : 0.15 Monomeric hydrophicity matching model chain A : 0.62 3D Compatibility (PKB) : -63.41 2D Compatibility (Sec. Struct. Predict.) : 0.15 1D Compatibility (Hydrophobicity) : 0.62 QMean score : -0.016

(partial model without unconserved sides chains): PDB file : Tito_3R5L.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3R5L-query.scw PDB file : Tito_Scwrl_3R5L.pdb: