Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MGIKMEKIFVIIFFVCLFISSITFLAYDFVSEEIKKLIIWMNVVFLILIIAMIIYPKLRK 2BG9 Chain:C ((452-474)) ---TIDRLSMFIITPVMVLGTIFIFV----------------------------------

General information: TITO was launched using: RESULT: Template: 2BG9.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain C - contact count / total energy / energy per contact / energy per residue : 14 -3096 -221.14 -134.61 target 2D structure prediction score : 0.83 Monomeric hydrophicity matching model chain C : 0.51 3D Compatibility (PKB) : -221.14 2D Compatibility (Sec. Struct. Predict.) : 0.83 1D Compatibility (Hydrophobicity) : 0.51 QMean score : 0.504

(partial model without unconserved sides chains): PDB file : Tito_2BG9.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2BG9-query.scw PDB file : Tito_Scwrl_2BG9.pdb: