Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKQFQLRRRKQMELVLPNNYVVIDEEEMMYLDGGAYLSKRACQGICVALAMSPGIFIALAGAAVLTKKLINYIKVGGLGGWL---IGAAAGVLATAAGKIAYCIGYGALNRGCDISGNPYPWDGFISATVR 3S1L Chain:A ((223-265)) ------------------------------------------------------------------------------AAWLQKEIGGAHGVLVTAVSPKAFSQAIGMVRRGGTIALNGLP----------

General information: TITO was launched using: RESULT: Template: 3S1L.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 101 -826 -8.17 -20.64 target 2D structure prediction score : 0.30 Monomeric hydrophicity matching model chain A : 0.58 3D Compatibility (PKB) : -8.17 2D Compatibility (Sec. Struct. Predict.) : 0.30 1D Compatibility (Hydrophobicity) : 0.58 QMean score : 0.033

(partial model without unconserved sides chains): PDB file : Tito_3S1L.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3S1L-query.scw PDB file : Tito_Scwrl_3S1L.pdb: