Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MTEIAAEFNCPPTTIHYALKAMGYSLKKS--RTYCEQDPEKVNRFLKELNHLSYLTPIYIYETGVETYFYLEYDRALSRQLVSLEEDIII 3EH9 Chain:A ((34-107)) ------------TGLQYAAKFIKKRRTKSSR-GVSREDIEREVSILKEIQHPNVITLHEVYENKTDVILILE------------------

General information: TITO was launched using: RESULT: Template: 3EH9.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 146 -684 -4.68 -12.00 target 2D structure prediction score : 0.51 Monomeric hydrophicity matching model chain A : 0.68 3D Compatibility (PKB) : -4.68 2D Compatibility (Sec. Struct. Predict.) : 0.51 1D Compatibility (Hydrophobicity) : 0.68 QMean score : 0.291

(partial model without unconserved sides chains): PDB file : Tito_3EH9.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3EH9-query.scw PDB file : Tito_Scwrl_3EH9.pdb: