Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MNIKSASDLLGISADTIRYYERVGLVPPITRTATGIRDFQDQDIEALEFIKCFRSAGVSVDSLVDYMSLYQKGDETREERLGILEEEKQKLEERLSQLQTALNRLNLKIKLYKEGKF 4WLW Chain:A ((2-70)) -NISDVAKITGLTSKAIRFYEEKGLVTPPMRSENGYRTYTQQHLNELTLLRQARQVGFNLEESGELVNLF-----------------------------------------------

General information: TITO was launched using: RESULT: Template: 4WLW.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 230 -41577 -180.77 -602.56 target 2D structure prediction score : 0.72 Monomeric hydrophicity matching model chain A : 0.75 3D Compatibility (PKB) : -180.77 2D Compatibility (Sec. Struct. Predict.) : 0.72 1D Compatibility (Hydrophobicity) : 0.75 QMean score : 0.794

(partial model without unconserved sides chains): PDB file : Tito_4WLW.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4WLW-query.scw PDB file : Tito_Scwrl_4WLW.pdb: