Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MLIHYPVYFFFELIQASCNEYIASGSNKEDIMLLNRKHSLVSCFDLELLETHPVKIKNSKVKQKNFITVSLEFSFKKIPPIF 3KF9 Chain:B ((1-22)) ----------------------------------------------------------KRRWKKNFIAVSAANRFKKISS--

General information: TITO was launched using: RESULT: Template: 3KF9.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 3 923 307.67 41.95 target 2D structure prediction score : 0.18 Monomeric hydrophicity matching model chain B : 0.53 3D Compatibility (PKB) : 307.67 2D Compatibility (Sec. Struct. Predict.) : 0.18 1D Compatibility (Hydrophobicity) : 0.53 QMean score : 0.408

(partial model without unconserved sides chains): PDB file : Tito_3KF9.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3KF9-query.scw PDB file : Tito_Scwrl_3KF9.pdb: