Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MSKVCQVTGKRPVVGNNVSHANNKTKRRFEPNLHHHRFWLESEKRFVRLRLTTKGMRIIDKLGIEKVV----ADLRAQGQKI 5MLC Chain:Y ((73-146)) --RICPFTGKKSNKANRVSHSNHKTKRLQFVNLQYKRVWWEAGKRFVKLRLSTKALKTIEKNGLDAVAKKAGIDLR------

General information: TITO was launched using: RESULT: Template: 5MLC.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain Y - contact count / total energy / energy per contact / energy per residue : 214 -17080 -79.81 -244.00 target 2D structure prediction score : 0.49 Monomeric hydrophicity matching model chain Y : 0.82 3D Compatibility (PKB) : -79.81 2D Compatibility (Sec. Struct. Predict.) : 0.49 1D Compatibility (Hydrophobicity) : 0.82 QMean score : 0.376

(partial model without unconserved sides chains): PDB file : Tito_5MLC.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5MLC-query.scw PDB file : Tito_Scwrl_5MLC.pdb: