Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MGITPMYVCLCRGITDQDIKDAIENGAESYREIRDLLDLGTC-CG-R-CAPEARAIISEELAEIAARISVAA 1Y56 Chain:A ((410-467)) ---EDVQICGC-DVSLKKVDEVIRKGITDLQIIKRLTHLAMGFCQGRYCLFNGAVVVSQRTG----------

General information: TITO was launched using: RESULT: Template: 1Y56.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 197 -28978 -147.10 -526.87 target 2D structure prediction score : 0.56 Monomeric hydrophicity matching model chain A : 0.70 3D Compatibility (PKB) : -147.10 2D Compatibility (Sec. Struct. Predict.) : 0.56 1D Compatibility (Hydrophobicity) : 0.70 QMean score : 0.653

(partial model without unconserved sides chains): PDB file : Tito_1Y56.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1Y56-query.scw PDB file : Tito_Scwrl_1Y56.pdb: