Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MEQIRPFPPTDFIDQADDEEATRLTPAPDLMDWVVKNYLTVDGELYNPDHDHIAELIHENEGFLAFAWASQACTVKKQMVSGQCEKVMFNVGGWRKARQEQQMRDWFGYVPVYLITIDASYCEQATDRDFCALIEHELYHIGVERDEDGEPLYSEMTGLPKHYLAGHDVEEFVGVVKRWGADENVKRLIEVAKQAPFVSDVNISKCCGTCLIN 4IL3 Chain:A ((273-313)) ---------------------------------------------------------------------------------------------------------------SKRIVLFDTLVNSNSTDEITAVLAHEIGHWQKN---------------------------------------------------------------------

General information: TITO was launched using: RESULT: Template: 4IL3.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 32 -9133 -285.41 -276.76 target 2D structure prediction score : 0.64 Monomeric hydrophicity matching model chain A : 0.56 3D Compatibility (PKB) : -285.41 2D Compatibility (Sec. Struct. Predict.) : 0.64 1D Compatibility (Hydrophobicity) : 0.56 QMean score : 0.422

(partial model without unconserved sides chains): PDB file : Tito_4IL3.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4IL3-query.scw PDB file : Tito_Scwrl_4IL3.pdb: