Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence-----------------------MSKIYIIKEMLFDQLLFGISSKQNGKVYGA----------------TLPFCFSNTQVSL------------
5AZW Chain:A ((2-95))GYFVSIDAHAEECFFERVTSGTKMGLIFEVAEGGFLDIDVEITGPDNKGIYKGDRESSGKYTFAAHMDGTYKFCFSNRMSTMTPKIVMFTIDIG


General information:
TITO was launched using:
RESULT:

Template: 5AZW.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 49 -216 -4.40 -5.01
target 2D structure prediction score : 0.35
Monomeric hydrophicity matching model chain A : 0.61

3D Compatibility (PKB) : -4.40
2D Compatibility (Sec. Struct. Predict.) : 0.35
1D Compatibility (Hydrophobicity) : 0.61
QMean score : 0.255

(partial model without unconserved sides chains):
PDB file : Tito_5AZW.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-5AZW-query.scw
PDB file : Tito_Scwrl_5AZW.pdb: