Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MESVYRQERKSNRKKGQMMIQKTRVMLYVNDVEMICRFFVEKIGAEISETIELPEEFKSIVLSISKELELGVFPKVFVQKFSPEVLGPPPSL--VFFTDEFETIYENMEEPGEITDNNGILTFNFSDPEGNYFVIGKAESSD 4BJT Chain:A ((108-176)) ---------------------------------------AEKLVQDLCDETGIRKNFSTSILTCLSG-DLMVFPRYFLNMFKDNV-NPPPNVPGIWTHDDDESLKSNDQE--------------------------------

General information: TITO was launched using: RESULT: Template: 4BJT.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 172 -13454 -78.22 -200.81 target 2D structure prediction score : 0.61 Monomeric hydrophicity matching model chain A : 0.64 3D Compatibility (PKB) : -78.22 2D Compatibility (Sec. Struct. Predict.) : 0.61 1D Compatibility (Hydrophobicity) : 0.64 QMean score : 0.452

(partial model without unconserved sides chains): PDB file : Tito_4BJT.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4BJT-query.scw PDB file : Tito_Scwrl_4BJT.pdb: