Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MILVNIEGRLEKDDGTEEKKGIQKEVTIDRKANLKSHRLYWIGRRAQDVFCSALALIILSPVMLITALAIVIDDLGGSPIFAQNKVSRNGRLFKFYKFCSMCVDAEAKLDALLSQNEMDGPVFKIKNDPRITRVGKFI 5TS4 Chain:B ((70-99)) -------------------------------------------------------------------------SDG-DRFEIELRVNFNGKTFRM-EIRMRKVNG---------------------------------

General information: TITO was launched using: RESULT: Template: 5TS4.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 49 -3039 -62.01 -101.28 target 2D structure prediction score : 0.30 Monomeric hydrophicity matching model chain B : 0.54 3D Compatibility (PKB) : -62.01 2D Compatibility (Sec. Struct. Predict.) : 0.30 1D Compatibility (Hydrophobicity) : 0.54 QMean score : 0.502

(partial model without unconserved sides chains): PDB file : Tito_5TS4.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5TS4-query.scw PDB file : Tito_Scwrl_5TS4.pdb: