Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence WFHGKISGQEAVQQLQPP-EDGLFLVRESGGHPGDYVLCVTFGRD---------VIHYRVLHRDGHLTIDEAVFFCNLMDMVEHY 2YU7 Chain:A ((8-92)) WYHGHMSGGQAETLLQAKGEPWTFLVRESLSQPGDFVLSVLSDQPKAGPGSPLRVTHIKVMCEGGRYTVGGLETFDSLTDLVEHF

General information: TITO was launched using: RESULT: Template: 2YU7.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 258 -15858 -61.47 -211.44 target 2D structure prediction score : 0.72 Monomeric hydrophicity matching model chain A : 0.79 3D Compatibility (PKB) : -61.47 2D Compatibility (Sec. Struct. Predict.) : 0.72 1D Compatibility (Hydrophobicity) : 0.79 QMean score : 0.563

(partial model without unconserved sides chains): PDB file : Tito_2YU7.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2YU7-query.scw PDB file : Tito_Scwrl_2YU7.pdb: