Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceWYQGEMSRKEAEGLLEK---DGDFLVRKSTTNPGSFVLTGMHNGQAKHL-LLVDPEGTIRTKDRVFDSISHLINHH
2HUW Chain:B ((8-83))WFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELVDYH


General information:
TITO was launched using:
RESULT:

Template: 2HUW.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 251 10268 40.91 142.61
target 2D structure prediction score : 0.76
Monomeric hydrophicity matching model chain B : 0.76

3D Compatibility (PKB) : 40.91
2D Compatibility (Sec. Struct. Predict.) : 0.76
1D Compatibility (Hydrophobicity) : 0.76
QMean score : 0.775

(partial model without unconserved sides chains):
PDB file : Tito_2HUW.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-2HUW-query.scw
PDB file : Tito_Scwrl_2HUW.pdb: