Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence FFYGSISRAEAEEHLKLAGMADGLFLLRQCLRSLGGYVLSLVHDVRFHHFPIERQLNGTYAIAGGKAHCGPAELCEFY 2OZO Chain:A ((10-154)) FFYGSISRAEAEEHLKLAGMADGLFLLRQCLRSLGGYVLSLVHDVRFHHFPIERQLNGTYAIAGGKAHCGPAELCEFY

General information: TITO was launched using: RESULT: Template: 2OZO.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 286 -53279 -186.29 -683.06 target 2D structure prediction score : 0.47 Monomeric hydrophicity matching model chain A : 1.00 3D Compatibility (PKB) : -186.29 2D Compatibility (Sec. Struct. Predict.) : 0.47 1D Compatibility (Hydrophobicity) : 1.00 QMean score : 0.486

(partial model without unconserved sides chains): PDB file : Tito_2OZO.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2OZO-query.scw PDB file : Tito_Scwrl_2OZO.pdb: