Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceWYFGKIGRKDAERQLLSPGNPQGAFLIRESETTKGAYSLSIRDWDQTRGDHVKHYKIRKLDMGGYYITTRVQFNSVQELVQHY
1O4F Chain:A ((7-89))WYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYY


General information:
TITO was launched using:
RESULT:

Template: 1O4F.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 292 -36588 -125.30 -440.82
target 2D structure prediction score : 0.69
Monomeric hydrophicity matching model chain A : 0.93

3D Compatibility (PKB) : -125.30
2D Compatibility (Sec. Struct. Predict.) : 0.69
1D Compatibility (Hydrophobicity) : 0.93
QMean score : 0.675

(partial model without unconserved sides chains):
PDB file : Tito_1O4F.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1O4F-query.scw
PDB file : Tito_Scwrl_1O4F.pdb: