Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceWFHGKLSRREAEALLQL---NGDFLVRESTTTPGQYVLTGLQSGQPKHL-LLVDPEGVVRTKDHRFESVSHLISYH
3MXC Chain:A ((9-84))WFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELVDYH


General information:
TITO was launched using:
RESULT:

Template: 3MXC.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 253 7133 28.19 99.07
target 2D structure prediction score : 0.75
Monomeric hydrophicity matching model chain A : 0.78

3D Compatibility (PKB) : 28.19
2D Compatibility (Sec. Struct. Predict.) : 0.75
1D Compatibility (Hydrophobicity) : 0.78
QMean score : 0.731

(partial model without unconserved sides chains):
PDB file : Tito_3MXC.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-3MXC-query.scw
PDB file : Tito_Scwrl_3MXC.pdb: