Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMAMIKFDHVDKYYG-KFHALKNINLEFEKGEVVVVIGPSGSGKSTMLRCINGL----ETISSGKLLIND-------------TDLHDKKTKLTEVRKNIGMVFQHFNLYPNKTVLENITLAPIKVLK-QDQATAVKNAEKFLKTVNMLDKKDSY--PSMLSGGQQQRVAIARGLAM-NPEMLLFDEPTSALDPEMIGDVLDVMKKLAHDGMSMIVVTHEMGFAKEVADRVIFM-ADGEVLEDSRNVRDFFENPNEVRAQQFISKVINH--
1B0U Chain:A ((5-261))-NKLHVIDLHKRYGG-HEVLKGVSLQARAGDVISIIGSSGSGKSTFLRCINFLEKPS----EGAIIVNGQNINLVRDKDGQLKVADKNQLRLLRT-R-LTMVFQHFNLWSHMTVLENVMEAPIQVL-GLSKHDARERALKYLAKVGIDERAQG-KYPVHLSGGQQQRVSIARALAME-PDVLLFDEPTSALDPELVGEVLRIMQQLAEEGKTMVVVTHEMGFARHVSSHVIFLH-QGKIEEEGDPEQVFGNP-QSPRLQQFLKGSLKKLE


General information:
TITO was launched using:
RESULT:

Template: 1B0U.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 1200 43550 36.29 187.71
target 2D structure prediction score : 0.66
Monomeric hydrophicity matching model chain A : 0.83

3D Compatibility (PKB) : 36.29
2D Compatibility (Sec. Struct. Predict.) : 0.66
1D Compatibility (Hydrophobicity) : 0.83
QMean score : 0.565

(partial model without unconserved sides chains):
PDB file : Tito_1B0U.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1B0U-query.scw
PDB file : Tito_Scwrl_1B0U.pdb: