Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MAQELLAQLQAGTAKFSDVLAYIEARYQHTPTAFQNGAQHNAATENQGSAKVFSFAKLQGLDQAQTLILFAEHYASVLAPPEGTDHQNIRQFMQNGWDGVKFEGQALTEK 2LWA Chain:C ((6-17)) ----------------------------------------------------------------------------------------IAAFIEGGWTGM----------

General information: TITO was launched using: RESULT: Template: 2LWA.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain C - contact count / total energy / energy per contact / energy per residue : 4 -433 -108.13 -36.04 target 2D structure prediction score : 0.75 Monomeric hydrophicity matching model chain C : 0.59 3D Compatibility (PKB) : -108.13 2D Compatibility (Sec. Struct. Predict.) : 0.75 1D Compatibility (Hydrophobicity) : 0.59 QMean score : 1.064

(partial model without unconserved sides chains): PDB file : Tito_2LWA.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2LWA-query.scw PDB file : Tito_Scwrl_2LWA.pdb: