Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MNKLMVAVFAGMVPLASFSAQAATPEQECQKLQDDYNLIYASKGFCFKDQDAKEKYG--NENCHTTKPKFSDKEQQRLDAIKERQKELKCK 3BX4 Chain:B ((25-55)) ----------------------------CPSGWSSY------EGHCYKPFNEPKNWADAERFCKL--------------------------

General information: TITO was launched using: RESULT: Template: 3BX4.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 36 2918 81.06 100.62 target 2D structure prediction score : 0.38 Monomeric hydrophicity matching model chain B : 0.61 3D Compatibility (PKB) : 81.06 2D Compatibility (Sec. Struct. Predict.) : 0.38 1D Compatibility (Hydrophobicity) : 0.61 QMean score : 0.459

(partial model without unconserved sides chains): PDB file : Tito_3BX4.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3BX4-query.scw PDB file : Tito_Scwrl_3BX4.pdb: