Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequencePSDGPEAPEELCFTTIIRRRDGFKYAEKGPIGQKIAFLAGLNCTVQKGCKLACTPAHYGLKYKVSCRPA
2KZ9 Chain:A ((1-69))MASAITALTPNQVNDELNKMQAFIRKEAEEKAKEIQLKADQEYEIEKTNIVRNETNNIDGNFKSKLKKA


General information:
TITO was launched using:
RESULT:

Template: 2KZ9.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 24 1522 63.40 22.05
target 2D structure prediction score : 0.39
Monomeric hydrophicity matching model chain A : 0.66

3D Compatibility (PKB) : 63.40
2D Compatibility (Sec. Struct. Predict.) : 0.39
1D Compatibility (Hydrophobicity) : 0.66
QMean score : -0.131

(partial model without unconserved sides chains):
PDB file : Tito_2KZ9.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-2KZ9-query.scw
PDB file : Tito_Scwrl_2KZ9.pdb: