Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence WYHGAISRTDAENLLRLCKEASYLVRNSETSKNDFSLSLKSSQGFMHMKLSRTKEHKYVLGQNSPPFSSVPEIVHHY 3UYO Chain:A ((18-93)) WYHGPVSRNAAEYLLSSGINGSFLVRESESSPGQRSISLRYEGRVYHYRINTASDGKLYVSSES-RFNTLAELVHHH

General information: TITO was launched using: RESULT: Template: 3UYO.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 271 -37771 -139.37 -496.98 target 2D structure prediction score : 0.59 Monomeric hydrophicity matching model chain A : 0.83 3D Compatibility (PKB) : -139.37 2D Compatibility (Sec. Struct. Predict.) : 0.59 1D Compatibility (Hydrophobicity) : 0.83 QMean score : 0.550

(partial model without unconserved sides chains): PDB file : Tito_3UYO.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3UYO-query.scw PDB file : Tito_Scwrl_3UYO.pdb: