Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence WYWGDISREEVNDKLRDMPDGTFLVRDASTKMQGDYTLTLRKGGNNKLIKTYHRDGKYGFSDPLTFNSVVELINHY 2PNA Chain:A ((22-97)) WYWGDISREEVNEKLRDTADGTFLVRDASTKMHGDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLTFNSVVELINHY

General information: TITO was launched using: RESULT: Template: 2PNA.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 259 -16596 -64.08 -218.36 target 2D structure prediction score : 0.80 Monomeric hydrophicity matching model chain A : 0.99 3D Compatibility (PKB) : -64.08 2D Compatibility (Sec. Struct. Predict.) : 0.80 1D Compatibility (Hydrophobicity) : 0.99 QMean score : 0.641

(partial model without unconserved sides chains): PDB file : Tito_2PNA.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2PNA-query.scw PDB file : Tito_Scwrl_2PNA.pdb: