Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MYYLPVDFYRYLIGREDQSVNEQVMIKCIDQQLKVNRLLIDQLDLSQVSHPKMREYLLNHIELTTVISSTLLNRSGTAEHLAKKRQLWTYIQQKNPEVFQAIRKTMLSRLTKHSVLPDRKLSNVVYQITKSVYGFN 5O5J Chain:O ((53-82)) -------------------------------------------------------------------------RRGLLLLVGRRRRLLKYVAQVDVARYRSLI---------------------------------

General information: TITO was launched using: RESULT: Template: 5O5J.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain O - contact count / total energy / energy per contact / energy per residue : 20 -4727 -236.33 -157.55 target 2D structure prediction score : 0.77 Monomeric hydrophicity matching model chain O : 0.52 3D Compatibility (PKB) : -236.33 2D Compatibility (Sec. Struct. Predict.) : 0.77 1D Compatibility (Hydrophobicity) : 0.52 QMean score : 0.790

(partial model without unconserved sides chains): PDB file : Tito_5O5J.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5O5J-query.scw PDB file : Tito_Scwrl_5O5J.pdb: