Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MGWIHICDSKMSNVDKIRKIHIIVCWMYIFLSFNPIISNTEYFLLIFLAFIYSIVSLPLYSVKNKIVSICLAINSILLMSFPILINKFFPESFLTYTVLISVFITELIIFHLIGEDFATKLTNEYKKISQFRSKVSQSPWIKYLEISSFILTIFPSILYGTVDNHVLTLIFLIKICVDTTIKFLFIRLFDTSTLMKRRIFFLFALDVIAYLFLGYLLVIQKAGYLFSVLLLFSNFSVPFIKEKEFELFKNSK 4W66 Chain:B ((151-206)) -------------------------------------------------------------------------------------AGWFGGERPVMADYFAAEAIEALRY-LLGREHDDALRTRLPHLCALARRMAQRPALA--------------------------------------------------------------------------------------------------------------

General information: TITO was launched using: RESULT: Template: 4W66.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 124 -24711 -199.28 -441.26 target 2D structure prediction score : 0.71 Monomeric hydrophicity matching model chain B : 0.41 3D Compatibility (PKB) : -199.28 2D Compatibility (Sec. Struct. Predict.) : 0.71 1D Compatibility (Hydrophobicity) : 0.41 QMean score : 0.315

(partial model without unconserved sides chains): PDB file : Tito_4W66.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4W66-query.scw PDB file : Tito_Scwrl_4W66.pdb: