Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MVMNLLFFREIEKTKASNFIQLSDWIATDSARNQLILKDILAQVAEGRNILVLVNRIQQIDVFEKLLKEKEVDDCYIISGKTKVRERERVYWRR 3MWY Chain:W ((548-632)) ----------------------LRGLIMSSGKMVLLDQLLTRLKKDGHRVLIFSQMVRMLDILGDYLSI-KGINFQRLDGTVPSAQRRISID--

General information: TITO was launched using: RESULT: Template: 3MWY.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain W - contact count / total energy / energy per contact / energy per residue : 137 -22063 -161.04 -319.75 target 2D structure prediction score : 0.74 Monomeric hydrophicity matching model chain W : 0.61 3D Compatibility (PKB) : -161.04 2D Compatibility (Sec. Struct. Predict.) : 0.74 1D Compatibility (Hydrophobicity) : 0.61 QMean score : 0.558

(partial model without unconserved sides chains): PDB file : Tito_3MWY.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3MWY-query.scw PDB file : Tito_Scwrl_3MWY.pdb: