Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MNDEANKQLTDARFKRLVGVQRTTFEEMLAVLKTAYQLKHAKGGRKPKLSLEDLLMATLQYV 3GFK Chain:B ((274-305)) --VQELANKTEEDMMKVRNLGRKSLEEVKAKLEE----------------------------

General information: TITO was launched using: RESULT: Template: 3GFK.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 43 -6172 -143.53 -192.88 target 2D structure prediction score : 0.59 Monomeric hydrophicity matching model chain B : 0.59 3D Compatibility (PKB) : -143.53 2D Compatibility (Sec. Struct. Predict.) : 0.59 1D Compatibility (Hydrophobicity) : 0.59 QMean score : 0.847

(partial model without unconserved sides chains): PDB file : Tito_3GFK.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3GFK-query.scw PDB file : Tito_Scwrl_3GFK.pdb: