Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MVETITIFVLAIFVGYYVVWGVTPALHTPLMAVTNALSSIIVVGAMLQTVGLPVLGVDANVAFQSVNVVSVLGAIAVFLASINIFGGFAVTARMLEMFKPKQKK 5SUL Chain:A ((521-558)) ---------LGVFPSYYEPWGYTPAECT-VMGVPSITTNVSGFGSYME--------------------------------------------------------

General information: TITO was launched using: RESULT: Template: 5SUL.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 136 -16726 -122.99 -440.16 target 2D structure prediction score : 0.13 Monomeric hydrophicity matching model chain A : 0.53 3D Compatibility (PKB) : -122.99 2D Compatibility (Sec. Struct. Predict.) : 0.13 1D Compatibility (Hydrophobicity) : 0.53 QMean score : 0.213

(partial model without unconserved sides chains): PDB file : Tito_5SUL.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5SUL-query.scw PDB file : Tito_Scwrl_5SUL.pdb: