Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MSKVCQVTGKRPVVGNNVSHANNKTKRRFEPNLHHHRFWLESEKRFVRLRLTTKGMRIIDKLGIEKVV----ADLRAQGQKI 5MMI Chain:Y ((73-148)) --RICPFTGKKSNKANRVSHSNHKTKRLQFVNLQYKRVWWEAGKRFVKLRLSTKALKTIEKNGLDAVAKKAGIDLRKE----

General information: TITO was launched using: RESULT: Template: 5MMI.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain Y - contact count / total energy / energy per contact / energy per residue : 232 -21544 -92.86 -299.22 target 2D structure prediction score : 0.49 Monomeric hydrophicity matching model chain Y : 0.82 3D Compatibility (PKB) : -92.86 2D Compatibility (Sec. Struct. Predict.) : 0.49 1D Compatibility (Hydrophobicity) : 0.82 QMean score : 0.526

(partial model without unconserved sides chains): PDB file : Tito_5MMI.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5MMI-query.scw PDB file : Tito_Scwrl_5MMI.pdb: