Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MARFYRRRKFCRFTAENVAYIDYKDIDTLKQYITENGKIVPSRITGTKARYQRQLALAIKQARYLSLIPYTDNHK 2UU9 Chain:R ((33-83)) ---------------------DYRNVEVLKRFLSETGKILPRRRTGLSAKEQRILAKTIKRARILGLLPFTE---

General information: TITO was launched using: RESULT: Template: 2UU9.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain R - contact count / total energy / energy per contact / energy per residue : 140 -13789 -98.49 -270.37 target 2D structure prediction score : 0.75 Monomeric hydrophicity matching model chain R : 0.77 3D Compatibility (PKB) : -98.49 2D Compatibility (Sec. Struct. Predict.) : 0.75 1D Compatibility (Hydrophobicity) : 0.77 QMean score : 0.672

(partial model without unconserved sides chains): PDB file : Tito_2UU9.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2UU9-query.scw PDB file : Tito_Scwrl_2UU9.pdb: